C11B3_RAT P30100
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P30100
Recommended name：Cytochrome P450 11B3, mitochondrial
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Cyp11b3
Gene names (synonym )：Cyp11b-3
Gene names (ORF )：
Length：500
Mass：57,122
Sequence：MALRVTADVWLARPWQCLHRTRALGTTATLAPKTLKPFEAIPQYSRNKWLKMIQILREQGQENLHLEMHQAFQELGPIFRHSAGGAQIVSVMLPEDAEKLHQVESILPRRMHLEPWVAHRELRGLRRGVFLLNGAEWRFNRLKLNPNVLSPKAVQNFVPMVDEVARDFLEALKKKVRQNARGSLTMDVQQSLFNYTIEASNFALFGERLGLLGHDLNPGSLKFIHALHSMFKSTTQLLFLPRSLTRWTSTQVWKEHFDAWDVISEYANRCIWKVHQELRLGSSQTYSGIVAALITQGALPLDAIKANSMKLTAGSVDTTAIPLVMTLFELARNPDVQQALRQETLAAEASIAANPQKAMSDLPLLRAALKETLRLYPVGGFLERILNSDLVLQNYHVPAGTLVLLYLYSMGRNPAVFPRPERYMPQRWLERKRSFQHLAFGFGVRQCLGRRLAEVEMLLLLHHMLKTFQVETLRQEDVQMAYRFVLMPSSSPVLTFRPIS
Tissue specificity：Expressed in the adrenal cortex and in different brain tissues, including hippocampus, hypothalamus, cerebellum, cerebral cortex, and midbrain. 1
Induction：
Developmental stage：Expression is greater in neonatal, compared to adult rat adrenal glands. 1
Protein families：