CNR1_RAT P20272
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P20272
Recommended name：Cannabinoid receptor 1
EC number：
Alternative names：Brain-type cannabinoid receptor
Cleaved into：
GeneID：25248
Gene names (primary )：Cnr1
Gene names (synonym )：Skr6 1 Publication
Gene names (ORF )：
Length：473
Mass：52,845
Sequence：MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEENIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
Tissue specificity：Expressed in the brain, in the striatum, medial septum, descending arm of the band of Broca, the amygdaloid nucleus, the hippocampus and cortex (at protein level). High levels in the lateral striatum. In rostral brain regions, high expression levels in the dorsal lateral striatum, while in the caudal brain regions, high levels are observed in the ventral lateral striatum (PubMed:10362691, PubMed:10891614, PubMed:16033894, PubMed:2165569). Expressed in monocytes/macrophages (at protein level) (PubMed:23955712). Expressed in striated muscles and in vascular smooth muscles cells (at protein level) (PubMed:10362691, PubMed:26671069). 6 s
Induction：
Developmental stage：
Protein families：