EST1C_RAT P10959
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P10959
Recommended name:Carboxylesterase 1C
EC number:EC:3.1.1.1
Alternative names:Carboxyesterase ES-1 (E1) ES-THET Esterase-2 Liver carboxylesterase 1 Neutral retinyl ester hydrolase (NREH) Retinyl ester hydrolase (REH)
Cleaved into:
GeneID:24346
Gene names (primary ):Ces1c
Gene names (synonym ):Es2
Gene names (ORF ):
Length:549
Mass:60,175
Sequence:MWLCALVWASLAVCPIWGHPSSPPVVDTTKGKVLGKYVSLEGFTQPVAVFLGVPFAKPPLGSLRFAPPEPAEPWSFVKNTTTYPPMCSQDGVVGKLLADMLSTGKESIPLEFSEDCLYLNIYSPADLTKNSRLPVMVWIHGGGLIIGGASPYSGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSRGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESAGGVSVSALVLSPLAKNLFHRAISESGVVLTTNLDKKNTQAVAQMIATLSGCNNTSSAAMVQCLRQKTEAELLELTVKLDNTSMSTVIDGVVLPKTPEEILTEKSFNTVPYIVGFNKQEFGWIIPTMMGNLLSEGRMNEKMASSFLKRFSPNLNISESVIPAIIEKYLRGTDDPAKKKELLLDMFSDVFFGIPAVLMSRSLRDAGAPTYMYEFQYRPSFVSDQRPQTVQGDHGDEIFSVFGTPFLKEGASEEETNLSKLVMKFWANFARNGNPNGEGLPHWPKYDQKEGYLQIGATTQQAQKLKGEEVAFWTELLAKNPPQTEHTEHT
Tissue specificity:
Induction:
Developmental stage:
Protein families: