EST1C_RAT   P10959


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P10959

Recommended name:Carboxylesterase 1C

EC number:EC:3.1.1.1

Alternative names:Carboxyesterase ES-1 (E1) ES-THET Esterase-2 Liver carboxylesterase 1 Neutral retinyl ester hydrolase (NREH) Retinyl ester hydrolase (REH)

Cleaved into:

GeneID:24346

Gene names  (primary ):Ces1c

Gene names  (synonym ):Es2

Gene names  (ORF ):

Length:549

Mass:60,175

Sequence:MWLCALVWASLAVCPIWGHPSSPPVVDTTKGKVLGKYVSLEGFTQPVAVFLGVPFAKPPLGSLRFAPPEPAEPWSFVKNTTTYPPMCSQDGVVGKLLADMLSTGKESIPLEFSEDCLYLNIYSPADLTKNSRLPVMVWIHGGGLIIGGASPYSGLALSAHENVVVVTIQYRLGIWGLFSTGDEHSRGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESAGGVSVSALVLSPLAKNLFHRAISESGVVLTTNLDKKNTQAVAQMIATLSGCNNTSSAAMVQCLRQKTEAELLELTVKLDNTSMSTVIDGVVLPKTPEEILTEKSFNTVPYIVGFNKQEFGWIIPTMMGNLLSEGRMNEKMASSFLKRFSPNLNISESVIPAIIEKYLRGTDDPAKKKELLLDMFSDVFFGIPAVLMSRSLRDAGAPTYMYEFQYRPSFVSDQRPQTVQGDHGDEIFSVFGTPFLKEGASEEETNLSKLVMKFWANFARNGNPNGEGLPHWPKYDQKEGYLQIGATTQQAQKLKGEEVAFWTELLAKNPPQTEHTEHT

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp