PNMT_RAT   P10937


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P10937

Recommended name:Phenylethanolamine N-methyltransferase

EC number:EC:2.1.1.28

Alternative names:PNMTase

Cleaved into:

GeneID:24661

Gene names  (primary ):Pnmt

Gene names  (synonym ):

Gene names  (ORF ):

Length:285

Mass:31,670

Sequence:MDRGSDPKHTAGMDSDSDPGQAEVALAYQRFEPRAYLRNNYAPPRGDLSNPDGVGPWKLRCMAQVFATGEVSGQVLIDIGSGPTIYQLLSACAHFEDITMTDFLEVNRQELGLWLREEPGAFDWSVYSQHVCLIEDKGESWQEKERQLRARVKRVLPIDVHKPQPLGASGLAPLPADALVSAFCLEAVSPDLPSFRQALYHITTLLRPGGNLLFIGALEESWYLAGEARLSVVPVSEEEVREALVCSGYEVRDLRTYIMPAHLRTGVDDVKGIFFAWAQKIEVQV

Tissue specificity:Expressed in the adrenal medulla and brain. 2 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp