URIC_RAT   P09118


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P09118

Recommended name:Uricase

EC number:EC:1.7.3.3

Alternative names:Urate oxidase

Cleaved into:

GeneID:114768

Gene names  (primary ):Uox

Gene names  (synonym ):

Gene names  (ORF ):

Length:303

Mass:34,934

Sequence:MAHYHDDYGKNDEVEFVRTGYGKDMVKVLHIQRDGKYHSIKEVATSVQLTLRSKKDYLHGDNSDIIPTDTIKNTVHVLAKFKGIKSIETFAMNICEHFLSSFSHVTRAHVYVEEVPWKRFEKNGVKHVHAFIHTPTGTHFCDVEQVRNGPPIIHSGIKDLKVLKTTQSGFEGFIKDQFTTLPEVKDRCFATQVYCKWRYQNRDVDFEATWGAVRDIVLKKFAGPYDRGEYSPSVQKTLYDIQVLTLSQLPEIEDMEISLPNIHYFNIDMSKMGLINKEEVLLPLDNPYGKITGTVRRKLPSRL

Tissue specificity:Expressed in liver. Not detected in other tissues tested. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp