GON1_RAT P07490
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P07490
Recommended name：Progonadoliberin-1
EC number：
Alternative names：Gonadoliberin-1 Alternative names: Gonadoliberin I, Gonadotropin-releasing hormone I (GnRH-I) , Luliberin I, Luteinizing hormone-releasing hormone I (LH-RH I) Prolactin release-inhibiting factor 1 Alternative names: Prolactin release-inhibiting factor I
Cleaved into：
GeneID：25194
Gene names (primary )：Gnrh1
Gene names (synonym )：Gnrh
Gene names (ORF )：
Length：92
Mass：10,500
Sequence：METIPKLMAAVVLLTVCLEGCSSQHWSYGLRPGGKRNTEHLVDSFQEMGKEEDQMAEPQNFECTVHWPRSPLRDLRGALERLIEEEAGQKKM
Tissue specificity：Central nervous system.
Induction：
Developmental stage：
Protein families：