KCRB_RAT P07335
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P07335
Recommended name:Creatine kinase B-type
EC number:EC:2.7.3.2
Alternative names:B-CK Creatine kinase B chain Creatine phosphokinase M-type (CPK-B)
Cleaved into:
GeneID:24264
Gene names (primary ):Ckb
Gene names (synonym ):Ckbb
Gene names (ORF ):
Length:381
Mass:42,725
Sequence:MPFSNSHNTQKLRFPAEDEFPDLSSHNNHMAKVLTPELYAELRAKCTPSGFTLDDAIQTGVDNPGHPYIMTVGAVAGDEESYDVFKDLFDPIIEDRHGGYQPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLSGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWINEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKNYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPHLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQPIDDLMPAQK
Tissue specificity:In the kidney localized primarily in the outer medulla in the thick ascending limb and distal convoluted tubule. 1
Induction:
Developmental stage:
Protein families:ATP:guanido phosphotransferase family