GSTP1_RAT P04906
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P04906
Recommended name：Glutathione S-transferase P Curated
EC number：EC:2.5.1.18
Alternative names：Chain 7 GST 7-7 GST class-pi
Cleaved into：
GeneID：24426
Gene names (primary )：Gstp1
Gene names (synonym )：
Gene names (ORF )：
Length：210
Mass：23,439
Sequence：MPPYTIVYFPVRGRCEATRMLLADQGQSWKEEVVTIDVWLQGSLKSTCLYGQLPKFEDGDLTLYQSNAILRHLGRSLGLYGKDQKEAALVDMVNDGVEDLRCKYGTLIYTNYENGKDDYVKALPGHLKPFETLLSQNQGGKAFIVGNQISFADYNLLDLLLVHQVLAPGCLDNFPLLSAYVARLSARPKIKAFLSSPDHLNRPINGNGKQ
Tissue specificity：Present in kidney, lung, testis and placenta, very low levels in liver.
Induction：
Developmental stage：
Protein families：