GSTA3_RAT P04904
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P04904
Recommended name：Glutathione S-transferase alpha-3 Curated
EC number：EC:2.5.1.18
Alternative names：GST 2-2 GST A3-3 GST AA Glutathione S-transferase Yc-1 (GST Yc1)
Cleaved into：
GeneID：24421
Gene names (primary )：Gsta3
Gene names (synonym )：Gstyc1
Gene names (ORF )：
Length：221
Mass：25,319
Sequence：MPGKPVLHYFDGRGRMEPIRWLLAAAGVEFEEQFLKTRDDLARLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYAEGVADLDEIVLHYPYIPPGEKEASLAKIKDKARNRYFPAFEKVLKSHGQDYLVGNRLSRADVYLVQVLYHVEELDPSALANFPLLKALRTRVSNLPTVKKFLQPGSQRKPLEDEKCVESAVKIFS
Tissue specificity：Liver from adult female rats contains about 2-fold greater levels of YC1 than is found in liver from adult male rats.
Induction：
Developmental stage：
Protein families：