GPX1_RAT P04041
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P04041
Recommended name：Glutathione peroxidase 1 Curated
EC number：EC:1.11.1.9
Alternative names：GPx-1; GSHPx-1
Cleaved into：
GeneID：24404
Gene names (primary )：Gpx1
Gene names (synonym )：
Gene names (ORF )：
Length：201
Mass：22,305
Sequence：MSAARLSAVAQSTVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTTRDYTEMNDLQKRLGPRGLVVLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKAHPLFTFLRNALPAPSDDPTALMTDPKYIIWSPVCRNDISWNFEKFLVGPDGVPVRRYSRRFRTIDIEPDIEALLSKQPSNP
Tissue specificity：Expressed in liver and lung. 1
Induction：
Developmental stage：
Protein families：