THY1_RAT P01830
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P01830
Recommended name:Thy-1 membrane glycoprotein
EC number:
Alternative names:CD90
Cleaved into:
GeneID:24832
Gene names (primary ):Thy1
Gene names (synonym ):Thy-1
Gene names (ORF ):
Length:161
Mass:18,172
Sequence:MNPVISITLLLSVLQMSRGQRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKCGGISLLVQNTSWLLLLLLSLSFLQATDFISL
Tissue specificity:Abundant in lymphoid tissues.
Induction:
Developmental stage:
Protein families: