SOCS2_RAT O88582
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88582
Recommended name：Suppressor of cytokine signaling 2
EC number：
Alternative names：Cytokine-inducible SH2 protein 2
Cleaved into：
GeneID：84607
Gene names (primary )：Socs2
Gene names (synonym )：Cish2
Gene names (ORF )：
Length：198
Mass：22,380
Sequence：MTLRCLEPSGNGADRTRSQWGTAGSPEDQSPEAARLAKALRELSQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPTLQHFCRLSINKCTGTIRGLPLPTRLKDYLEEYKFQV
Tissue specificity：
Induction：
Developmental stage：
Protein families：