B2L11_RAT O88498
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88498
Recommended name:Bcl-2-like protein 11
EC number:
Alternative names:Bcl-2-related ovarian death protein Bcl2-interacting mediator of cell death
Cleaved into:
GeneID:
Gene names (primary ):Bcl2l11
Gene names (synonym ):Bim, Bod
Gene names (ORF ):
Length:196
Mass:22,056
Sequence:MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH
Tissue specificity:Widely expressed.
Induction:
Developmental stage:
Protein families:Bcl-2 family