CP27B_RAT O35132
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35132
Recommended name：25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
EC number：EC:1.14.15.18
Alternative names：25-OHD-1 alpha-hydroxylase 25-hydroxyvitamin D(3) 1-alpha-hydroxylase (VD3 1A hydroxylase) Calcidiol 1-monooxygenase Cytochrome P450 subfamily XXVIIB polypeptide 1 Cytochrome P450C1 alpha More alternative names
Cleaved into：
GeneID：114700
Gene names (primary )：Cyp27b1
Gene names (synonym )：Cyp27b
Gene names (ORF )：
Length：501
Mass：55,369
Sequence：MTQAVKLASRVFHRVQLPSQLGSDSVLRSLSDIPGPSTPSFLAELFCKGGLSRLHELQVHGAARYGPIWSGSFGTLRTVYVADPALVEQLLRQESHCPERCSFSSWSEHRRRHQRACGLLTADGEEWQRLRSLLAPLLLRPQAAAGYAGTLDSVVSDLVRRLRRQRGRGSGLPDLVLDVAGEFYKFGLEGIGAVLLGSRLGCLEAEVPPDTETFIEAVGSVFVSTLLTMAMPSWLHRLIPGPWARLCRDWDQMFAFAQKHVEQREGEAAVRNQGKPEEDLPTGHHLTHFLFREKVSVQSIVGNVTELLLAGVDTVSNTLSWALYELSRHPEVQSALHSEITGAVNPGSYAHLQATALSQLPLLKAVIKEVLRLYPVVPGNSRVPDRDICVGNYVIPQDTLVSLCHYATSRDPAQFREPNSFNPARWLGEGPAPHPFASLPFGFGKRSCIGRRLAELELQMALAQILTHFEVLPEPGALPVKPMTRTVLVPERSIHLQFVDR
Tissue specificity：Kidney.
Induction：
Developmental stage：
Protein families：