TPPP_RAT   D3ZQL7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:D3ZQL7

Recommended name:Tubulin polymerization-promoting protein 1 Publication

EC number:EC:3.6.5.-

Alternative names:TPPP 1 Publication

Cleaved into:

GeneID:361466

Gene names  (primary ):Tppp 1 Publication

Gene names  (synonym ):

Gene names  (ORF ):

Length:218

Mass:23,547

Sequence:MADSKAKPTKAANKTPPKSPGDPAKAAKRLSLESEGANEGAAAAPELSALEEAFRRFAVHGDTRATGKEMHGKNWSKLCKDCHVIDGKNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGRAPVISGVTKAVSSPTVSRLTDTSKFTGSHKERFDQSGKGKGKAGRVDLVDESGYVPGYKHAGTYDQKVQGGK

Tissue specificity:Predominantly expressed in mature oligodendrocytes. 1

Induction:

Developmental stage:Strongly up-regulated during the differentiation of primary oligodendrocyte cells. 1

Protein families:TPPP family


   💬 WhatsApp