TOX3_RAT   B7SBD2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B7SBD2

Recommended name:TOX high mobility group box family member 3

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Tox3

Gene names  (synonym ):Tnrc9

Gene names  (ORF ):

Length:577

Mass:63,503

Sequence:MDVRFYPAAAGDPAGLDFAQCLGYYGYSKLGNNNYMNMAEANNAFFAASEQTFHTPSLGDEEFEIPPITPPPESDPTLGMPDVLLPFQTLSDPLPSQGNEFTPQFPPQSLDLPSITISRNLVEQDGVLHSNGLHMDQSHTQVSQYRQDPSLVMRSIVHMTDAARSGIMPPAQLTTINQSQLSAQLGLNLGGASVPHTSPSPPASKSATPSPSSSINEEDADETNRAVGEKRTAPDSGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYRASLVSKAAAESAEAQTIRSVQQTLASTNLTSSLLLNTSLSQHGTVPASPQTLPQSLPRSIAPKPLTMRLPMSQIVTSVTIAANMPSNIGAPLISSMGTTMVGSVSSTQVSPSVQTQQHQLQLQQQQQQQQQQMQQMQHQQLQQHQMHQQIQQQMQQQHFQHHMQQHLQQQQQQHLQQQISQQQLQQQLQQHLQLQQQLQHMQHQSQPSPRQHSPVTSQITSPIPAIGSPQPASQQHQPQIQSQTQTQVLPQVSIF

Tissue specificity:Expressed in the cortex and cerebellum. 1

Induction:

Developmental stage:Expressed in the cortex and cerebellum at 18 dpc. 1

Protein families:


   💬 WhatsApp