SEP11_RAT   B3GNI6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B3GNI6

Recommended name:Septin-11

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Septin11 By Similarity

Gene names  (synonym ):Sept11 Imported

Gene names  (ORF ):

Length:431

Mass:49,695

Sequence:MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDPATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLFNYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQIYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVKEKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVSNFQKKKAAAQLLQSQAQQSGAQQTKKDKDKKNPWLCTE

Tissue specificity:Highly expressed in cerebellum, olfactory bulb, hippocampus, cerebral cortex, thalamus, and corpus striatum. In the hippocampus, strong expression around the pyramidal cells of the stratum pyramidale and in the stratum lucidum of the CA2-CA3 regions. In the olfactory bulb, particularly strong expression in the external plexiform layer. In the cerebellum, concentrates in the molecular layer, particularly in Purkinje cells, where it is found at the base of dendritic spines/protrusions, at the dendritic branching points and in some GABAergic synapses. 1

Induction:

Developmental stage:Expressed in the embryo and in early postnatal weeks. On and before P14, distributes in a homogeneous way, throughout the brain. By P21, high expression observed in the molecular layer of the cerebellum and in the olfactory bulb. The maximum expression and the adult pattern of distribution in the brain occurs by P30. By P30, P45 and P90, highest expression occurs in the molecular layer of the cerebellum and in the olfactory bulb, and relatively high expression in the hippocampus, cerebral cortex, thalamus and corpus striatum. 1

Protein families:


   💬 WhatsApp