SFRP1_RAT Q9R168
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R168
Recommended name：Secreted frizzled-related protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Sfrp1
Gene names (synonym )：
Gene names (ORF )：
Length：158
Mass：18,072
Sequence：VRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKRLVLFLKNGADCPCHQLDNLSHNFLIMGRKVKSQYLLTAIHKWDKKNKE
Tissue specificity：Differentially expressed in developing kidney. In 16 dpc embryos, highly expressed around the ureter and, also in all stromal elements, including the interstitial populations of the medulla and the outer layer of the cortex. In 19 dpc embryos, expression in the medulla is increased and is also found in the mesenchymal tissue surrounding the developing ureter. 1
Induction：
Developmental stage：
Protein families：secreted frizzled-related protein (sFRP) family