SO1B2_RAT   Q9QZX8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QZX8

Recommended name:Solute carrier organic anion transporter family member 1B2

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Slco1b2

Gene names  (synonym ):Oatp1b2, Slc21a10

Gene names  (ORF ):

Length:687

Mass:76,767

Sequence:MDHTQQSRKAAEAQPSRSKQTRFCDGFKLFLAALSFSYICKALGGVVMKSSITQIERRFDIPSSISGLIDGGFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGSILTALPHFFMGYYKYAKENDIGSLGNSTLTCFINQMTSPTGPSPEIVEKGCEKGLKSHMWIYVLMGNMLRGIGETPIVPLGISYLDDFAKEGHTSMHLGTLHTIAMIGPILGFIMSSVFAKIYVDVGYVDLNSVRITPNDARWVGAWWLSFIVNGLLCITSSIPFFFLPKIPKRSQEERKNSVSLHAPKTDEEKKHMTNLTKQEEQDPSNMTGFLRSLRSILTNEIYVIFLILTLLQVSGFIGSFTYLFKFIEQQFGRTASQANFLLGIITIPTMATAMFLGGYIVKKFKLTSVGIAKFVFFTSSVAYAFQFLYFPLLCENKPFAGLTLTYDGMNPVDSHIDVPLSYCNSDCSCDKNQWEPICGENGVTYISPCLAGCKSFRGDKKPNNTEFYDCSCISNSGNNSAHLGECPRYKCKTNYYFYIILQVTVSFFTAMGSPSLILILMKSVQPELKSLAMGFHSLIIRALGGILAPIYYGAFIDRTCIKWSVTSCGKRGACRLYNSRLFGFSYLGLNLALKTPPLFLYVVLIYFTKRKYKRNDNKTLENGRQFTDEGNPDSVNKNGYYCVPYDEQSNETPL

Tissue specificity:Liver specific. Expression is highest in central perivenous hepatocytes and lowest in the periportal region. Isoform 1 predominates. Not detected in heart, brain, kidney, skeletal muscle, lung, testis or spleen.

Induction:

Developmental stage:

Protein families:organo anion transporter (TC 2.A.60) family


   💬 WhatsApp