SO1B2_RAT Q9QZX8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QZX8
Recommended name:Solute carrier organic anion transporter family member 1B2
EC number:
Alternative names:
Cleaved into:
GeneID:
Gene names (primary ):Slco1b2
Gene names (synonym ):Oatp1b2, Slc21a10
Gene names (ORF ):
Length:687
Mass:76,767
Sequence:MDHTQQSRKAAEAQPSRSKQTRFCDGFKLFLAALSFSYICKALGGVVMKSSITQIERRFDIPSSISGLIDGGFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGSILTALPHFFMGYYKYAKENDIGSLGNSTLTCFINQMTSPTGPSPEIVEKGCEKGLKSHMWIYVLMGNMLRGIGETPIVPLGISYLDDFAKEGHTSMHLGTLHTIAMIGPILGFIMSSVFAKIYVDVGYVDLNSVRITPNDARWVGAWWLSFIVNGLLCITSSIPFFFLPKIPKRSQEERKNSVSLHAPKTDEEKKHMTNLTKQEEQDPSNMTGFLRSLRSILTNEIYVIFLILTLLQVSGFIGSFTYLFKFIEQQFGRTASQANFLLGIITIPTMATAMFLGGYIVKKFKLTSVGIAKFVFFTSSVAYAFQFLYFPLLCENKPFAGLTLTYDGMNPVDSHIDVPLSYCNSDCSCDKNQWEPICGENGVTYISPCLAGCKSFRGDKKPNNTEFYDCSCISNSGNNSAHLGECPRYKCKTNYYFYIILQVTVSFFTAMGSPSLILILMKSVQPELKSLAMGFHSLIIRALGGILAPIYYGAFIDRTCIKWSVTSCGKRGACRLYNSRLFGFSYLGLNLALKTPPLFLYVVLIYFTKRKYKRNDNKTLENGRQFTDEGNPDSVNKNGYYCVPYDEQSNETPL
Tissue specificity:Liver specific. Expression is highest in central perivenous hepatocytes and lowest in the periportal region. Isoform 1 predominates. Not detected in heart, brain, kidney, skeletal muscle, lung, testis or spleen.
Induction:
Developmental stage:
Protein families:organo anion transporter (TC 2.A.60) family