BID_RAT   Q9JLT6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JLT6

Recommended name:BH3-interacting domain death agonist

EC number:

Alternative names:BH3-interacting domain death agonist p15 Alternative names: p15 BID BH3-interacting domain death agonist p13 Alternative names: p13 BID BH3-interacting domain death agonist p11 Alternative names: p11 BID

Cleaved into:

GeneID:64625

Gene names  (primary ):Bid

Gene names  (synonym ):

Gene names  (ORF ):

Length:196

Mass:22,249

Sequence:MDSEVSNGSGLGAEHITNLLVFGFLRNNDRDFHQELEVLGQELPVQVYLEGDREDELQTDGSRASRSFYHGRIEPDSESQDEVIHNIARHLAQAGDELDHSIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTSFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFRTTVNFINQNLFSYVRDLVRNEMD

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp