KCNQ4_RAT Q9JK96
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JK96
Recommended name:Potassium voltage-gated channel subfamily KQT member 4
EC number:
Alternative names:
Cleaved into:
GeneID:298496
Gene names (primary ):Kcnq4
Gene names (synonym ):
Gene names (ORF ):
Length:695
Mass:77,061
Sequence:MAEAPPRRLGLGPPPGDAPRAELVALTAVQSEQGEAGGGGSPRRLGLLGSPLPPGAPLPGPGSGSGSACGQRSSAAHKRYRRLQNWVYNVLERPRGWAFVYHVFIFLLVFSCLVLSVLSTIQEHQELANECLLILEFVMIVVFGLEYIIRVWSAGCCCRYRGWQGRFRFARKPFCVIDFIVFVASVAVIAAGTQGNIFATSALRSMRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFASFLVYLAEKDANSDFSSYADSLWWGTITLTTIGYGDKTPHTWLGRVLAAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAWRLYSTDTSRAYLTATWYYYDSILPSFRELALLFEHIQRARNGGLRPLEVRRAPVPDGAASRYPPVATCHRPGSASFCPGESSRMGIKDRIRMSSSQKRTGPSKQHLAPPPIPTSPSSEQVGEASSPSKVQKSWSFNDRTRFRASLRLKPRCSTEEGPSEEVAEEKSYQCELTVDDVMPTVKTVIRSVRILKFLVAKRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSLQARVDQIVGRGPGDRKTREKGDKGPSDTEAVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGTVQVPLFDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD
Tissue specificity:Expressed in both the inner (IHCs) and the outer hair cells (OHCs) of the cochlea. Reciprocal longitudinal gradients of expression is present in IHCs and OHCs. The strongest expression in IHCs is in the base of the cochlea and in the apex for OHCs. A basal to apical gradient of expression is also present in both type I and type II spiral ganglion cells. 1
Induction:
Developmental stage:At P0 expression is primarily in the basal hook to lower middle turn of the cochlea and progressively expands toward the apex over time. By P8, the expression is evident in both IHCs and OHCs along the entire length of the cochlea. Then the adult pattern begins to emerge, as expression in basal OHCs and in apical IHCs decreases. 1
Protein families: