EBP_RAT Q9JJ46
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JJ46
Recommended name：3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase Curated
EC number：EC:5.3.3.5
Alternative names：Cholestenol Delta-isomerase Cholesterol-5,6-epoxide hydrolase subunit EBP By Similarity (EC:3.3.2.11 By Similarity) . EC:3.3.2.11 (UniProtKB | ENZYME | Rhea) By Similarity Delta(8)-Delta(7) sterol isomerase (D8-D7 sterol isomerase) Emopamil-binding protein Sterol 8-isomerase
Cleaved into：
GeneID：117278
Gene names (primary )：Ebp
Gene names (synonym )：Rsi
Gene names (ORF )：
Length：230
Mass：26,738
Sequence：MTTNMLPLHPYWPRHLRLDNFVPNDLPTWHILVGLFSFSGVLIVITWLLSSRVSVVPLGTGRRLALCWFAVCTFIHLVIEGWFSFYHEILLEDQAFLSQLWKEYSKGDSRYILSDGFIVCMESVTACLWGPLSLWVVIAFLRHQPFRFVLQLVVSVGQIYGDVLYFLTELRDGFQHGELGHPLYFWFYFVIMNAIWLVIPGILVFDAIKHLTNAQSMLDNKVMKIKSKHN
Tissue specificity：Expressed in liver. 1
Induction：
Developmental stage：Expression in liver is reduced by 70% in 2 years old rats compare to 3 weeks old. 1
Protein families：