VAMP7_RAT   Q9JHW5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JHW5

Recommended name:Vesicle-associated membrane protein 7

EC number:

Alternative names:Synaptobrevin-like protein 1

Cleaved into:

GeneID:85491

Gene names  (primary ):Vamp7

Gene names  (synonym ):Sybl1

Gene names  (ORF ):

Length:220

Mass:24,776

Sequence:MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRIVYLCITDDDFERSRAFGFLNEVKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSENQSLDRVTETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLARAMCVKNVKLTAIIVVVSIVFIYIIVSPLCGGFTWPSCVKK

Tissue specificity:Expressed in brain, kidney, liver, lung, spleen and thymus. Not expressed in heart and skeletal muscle. 4 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp