TSNAX_RAT   Q9JHB5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JHB5

Recommended name:Translin-associated protein X

EC number:

Alternative names:

Cleaved into:

GeneID:64028

Gene names  (primary ):Tsnax

Gene names  (synonym ):Trax

Gene names  (ORF ):

Length:290

Mass:33,005

Sequence:MNGKEGPGGFRKRKHDNFPHNQRREGKDASSSSPVMLAFKSFQQELDTRHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEEILTESESKLDGVRQKMLQVAQELSGEDMHQFHRAVTTGLQEYVEAVSFQHFIRTRSLISMEEINRQLTFTTDDSGKESKAPPADGQDKQLVTWRLKITPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLSKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEESIS

Tissue specificity:Detected in cerebellum. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp