GPR88_RAT Q9ESP4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ESP4
Recommended name:G protein-coupled receptor 88 Curated
EC number:
Alternative names:
Cleaved into:
GeneID:64443
Gene names (primary ):Gpr88
Gene names (synonym ):Strg
Gene names (ORF ):
Length:384
Mass:40,200
Sequence:MTNSSSTSTSTTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFRKLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPAGSAEPPGDWDSGGGSYRLLRGGLLGLGLTVSLLSHCLVALNRYLLITRAPATYQVLYQRRHTAGMLALSWALALGLVLLLPPWAPKPGAEPPQVHYPALLAAGALLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGCAAAAAAFPAAPHAPGAGGAAHPAQPQPLPAALQPRRAQRRLSGLSVLLLCCVFLLATQPLVWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSVLPGVGDAAAAAAAATAVPAMSQAQLGTRAAGQHW
Tissue specificity:Expressed predominantly in the striatum (PubMed:11056049). Expressed also in olfactory tubercle, nucleus accumbens, amygdala, and neocortex. Spinal cord, pons, and medulla expression remains discrete (PubMed:26918661). Also expressed in peripheral tissues, including adrenal cortex (16 dpc to 21 dpc) and cochlear ganglia (19 dpc to P3) and also at moderate levels in retina (18 dpc to 19 dpc) and spleen (21 dpc to P7) (PubMed:26918661). 2 s
Induction:
Developmental stage:Detected at embryonic day 16 (16 dpc) in the striatum. From 16 dpc to 20 dpc to adulthood, the highest expression levels of protein is observed in the striatum, olfactory tubercle, nucleus accumbens, amygdala, and neocortex. 1
Protein families: