PRAF3_RAT   Q9ES40


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9ES40

Recommended name:PRA1 family protein 3

EC number:

Alternative names:

Cleaved into:

GeneID:66028

Gene names  (primary ):Arl6ip5

Gene names  (synonym ):Gtrap3-18, Jwa, Pra2, Praf3

Gene names  (ORF ):

Length:188

Mass:21,549

Sequence:MDVNLAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGFLSPFNMILGGIIVVLVFTGFVWAAHNKDILRRMKKQYPTAFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKKTPMGIILDALEQQEDSINKFADYISKARE

Tissue specificity:Ubiquitous (PubMed:11096102). Most abundant in heart and brain (PubMed:11096102). In the embryonic brain cortex, expressed in neurons and astrocytes (PubMed:19720795). 2 s

Induction:

Developmental stage:By methyl-beta-cyclodextrin. By Similarity

Protein families:


   💬 WhatsApp