ATF4_RAT   Q9ES19


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9ES19

Recommended name:Cyclic AMP-dependent transcription factor ATF-4

EC number:

Alternative names:Activating transcription factor 4 1 Publication (rATF-4 1 Publication)

Cleaved into:

GeneID:79255

Gene names  (primary ):Atf4 1 Publication

Gene names  (synonym ):

Gene names  (ORF ):

Length:347

Mass:38,152

Sequence:MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAGSSEWLAMDGLVSASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLATLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESVIKVDQAAPFTFLQPLPCSPGFLSSTPDHSFSLELGSEVDISEGDRKPDSAAYITLTPQCVKEEDTPSDSDSGICMSPESYLGSPQHSPSTSRAPPDSLPSPGVPRGSRPKPYDPPGVSVTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP

Tissue specificity:Expressed in brain, heart, liver, spleen, lung and muscle, but not testis. 1

Induction:

Developmental stage:

Protein families:bZIP family


   💬 WhatsApp