HDAC7_RAT   Q99P96


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99P96

Recommended name:Histone deacetylase 7

EC number:EC:3.5.1.98

Alternative names:HD7

Cleaved into:

GeneID:

Gene names  (primary ):Hdac7

Gene names  (synonym ):Hdac7a

Gene names  (ORF ):

Length:238

Mass:26,101

Sequence:TPGSQPQPMDLRVGQRPTVEPPPEPALLTLQHPQRLHRHLFLAGLQQQQRSAEPMRLSMDPPLPELQGGQQEQELRQLLNKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPSSPSIPYRTLEPLDTEGAARSVLSSFLPPVPSLPTEPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPALGSEADG

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp