TX101_RAT   Q924B5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q924B5

Recommended name:Testis-expressed protein 101 By Similarity

EC number:

Alternative names:

Cleaved into:

GeneID:207113

Gene names  (primary ):Tex101

Gene names  (synonym ):

Gene names  (ORF ):

Length:250

Mass:27,004

Sequence:MGACRIQYILLVFLLIASHWTLVQNIYCEVSRTLSLEDNPSGTFNWTSKAEKCNPGEFCQETVLLIKAEGTKTAILASKSCVPQGAETMTFVQYTAPPGLVAISYSNYCNDSLCNNRNNLASILQAPEPTATSNMSGARHCPTCLALEPCSSAPSMPCANGTTQCYHGKIELSGGGMDSVVHVKGCTTAIGCRLMAKMESVGPMTVKETCSYQSFLHPRMAEIGASWMPTSLWVLELLLPALSLPLIYFP

Tissue specificity:Detected in testis. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp