PAR3_RAT   Q920E1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q920E1

Recommended name:Proteinase-activated receptor 3

EC number:

Alternative names:Coagulation factor II receptor-like 2 Thrombin receptor-like 2

Cleaved into:

GeneID:29636

Gene names  (primary ):F2rl2

Gene names  (synonym ):Par3

Gene names  (ORF ):

Length:368

Mass:41,796

Sequence:MEMKVLILVGVRLLFLPTTVCQSGMKHVSDNSALTAESFNGNEHSFEEFPLSDIEGWTGATTTIKAKCPEESITTLHVNNATMGYLRSSLSTKVIPAIYILVFVIGVPANIVTLWKLSSRTKSICLVIFHTNLAIADLLFCVTLPFKIAYHLNGNDWVFGEVMCRVTTVAFYGNMYCAILILTCMGINRYLATVHPFTYRKLPKRNFTLLMCGVVWVMVVLYMLPLAILKQEYHLVQPGITTCHDVHDTCESPLPFQFYYFVSLAFFGFLIPFVVSVFCYTTLIHKLNAQDRKWLRYIKAVLLILVIFTICFAPTNIILIIHHANYYYSNTDSLYFMYLIALCLGSLNSCLDPFLYFIMSKIVDQLTS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp