CHP2_RAT   Q810D1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q810D1

Recommended name:Calcineurin B homologous protein 2

EC number:

Alternative names:

Cleaved into:

GeneID:308965

Gene names  (primary ):Chp2

Gene names  (synonym ):

Gene names  (ORF ):

Length:196

Mass:22,486

Sequence:MGSRSSHVALIPDVDQIRRETGFSQASLLRLYHRFQALDREEKGFLSRLDLQQIGALAVNPLGDRIIDSFFPNGSQRVYFAGFARVLAYFRPIDEDDATLRDPKQPEPLNSRMNKLRFAFQLYDLDRDGKISRNEMLQVLRLMVGVQVTDEQLESITDRTVQEADEDGDGAVSFLEFAKSLEKMNIEQKMSIRILK

Tissue specificity:Expressed in brain, lungs, stomach and intestines (at protein level). Strongly expressed in the epithelial layer on the small intestinal luminal side. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp