LIN7C_RAT   Q792I0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q792I0

Recommended name:Protein lin-7 homolog C

EC number:

Alternative names:Mammalian lin-seven protein 3 (MALS-3) Vertebrate lin-7 homolog 3 (Veli-3)

Cleaved into:

GeneID:60442

Gene names  (primary ):Lin7c

Gene names  (synonym ):Mals3, Veli3

Gene names  (ORF ):

Length:197

Mass:21,834

Sequence:MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT

Tissue specificity:Expressed in brain, kidney (outer medullary collecting duct) and liver with weak expression in thymus and heart. 3 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp