TP4A1_RAT Q78EG7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q78EG7
Recommended name：Protein tyrosine phosphatase type IVA 1
EC number：EC:3.1.3.48
Alternative names：Protein-tyrosine phosphatase 4a1 Protein-tyrosine phosphatase of regenerating liver 1 (PRL-1)
Cleaved into：
GeneID：29463
Gene names (primary )：Ptp4a1
Gene names (synonym )：Prl1
Gene names (ORF )：
Length：173
Mass：19,815
Sequence：MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ
Tissue specificity：Brain (neurons and oligodendrocytes), skeletal muscle, regenerating liver, tumor cell lines. Expressed in enterocytes of the small intestine villi and colonic surface, zymogen cells of the stomach, proximal tubule cells of the kidney, bronchiolar epithelium, but not in esophagus and heart (at protein level). 3 s
Induction：Expressed in fetal brain. Up-regulated during oligodendroglial differentiation. Expressed in the developing intestine, esophagus, liver, kidney and lung (at protein level). 3 Publications
Developmental stage：By hepatectomy, mitogens, and ischemia-reperfusion. 1
Protein families：