PLPR1_RAT Q6WAY2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6WAY2
Recommended name：Phospholipid phosphatase-related protein type 1 By Similarity
EC number：
Alternative names：
Cleaved into：
GeneID：298062
Gene names (primary )：Plppr1
Gene names (synonym )：Lppr1 By Similarity, Prg3
Gene names (ORF )：
Length：325
Mass：35,887
Sequence：MAVENNTQRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFQVHIQGFFCQDGDLMKPYPGTEEESFISPLVLYCVLAATPTAIIFIGEISMYFIKSTRESLIAEEKMILTGDCCYLSPLLRRIVRFIGVFAFGLFATDIFVNAGQVVTGHLTPYFLTVCQPNYTSTDCRAHHQFINNGNICTGDLEVIEKARRSFPSKHAALSIYSALYATMYITSTIKTKSSRLAKPVLCLGDLCTAFLTGLNRVSEYRNHCSDVIAGFILGTAVALFLGMCVVHNFKGTQGSASKPKPEDPRGVPLMAFPRIESPLETLSAQNHSASMTEVT
Tissue specificity：Highly expressed in the brain. Also found in the liver, kidney and testis. In the brain shows a strongest expression in the hippocampus and cerebellum. 1
Induction：At embryonic day 16 (16 dpc) can be detected in the hippocampal anlage, thalamus, cortex and olfactory bulb. At perinatal stages (20 dpc to P1) shows a strong expression in the cortex and hippocampus and subsequently declines at later postnatal stages. 1 Publication
Developmental stage：Shows a transient down-regulation due to overexcitation of neurons induced by kainic acid. 1
Protein families：