FICD_RAT   Q6AY47


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6AY47

Recommended name:Protein adenylyltransferase FICD Curated

EC number:EC:2.7.7.108

Alternative names:AMPylator FICD By Similarity De-AMPylase FICD By Similarity (EC:3.1.4.- By Similarity) . EC:3.1.4.- (UniProtKB | ENZYME | Rhea) By Similarity FIC domain-containing protein By Similarity

Cleaved into:

GeneID:288741

Gene names  (primary ):Ficd

Gene names  (synonym ):

Gene names  (ORF ):

Length:458

Mass:51,754

Sequence:MILMPMASVVAVAEPKWVSVWGRFLWMTLLSMALGSLLALLLPLGAVEEQCLAVLRGFHLLRSKLDRAQHVVTKCTSPSTELSVTSRDAGLLTVKTKASPAGKLEAKAALNQALEMKRQGKRGKAHKLFLHALKMDPGFVDALNELGIFSEEDKDIIQADYLYTRALTISPFHEKALINRDRTLPLVEEIDQRYFSVLDSKVRKVMSIPKGSSALRRVMEETYYHHIYHTVAIEGNTLTLAEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINSTLVSRIGSVTIDHMLEIHRRVLGYVDPVEAGRFRRTQVLVGHHIPPHPRDVEKQMQEFTQWLNSEDAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSEYYHVLEVANEGDVRPFIRFIAKCTEVTLDTLLLATTEYSAALPEAQPNHSGFKETLPVRP

Tissue specificity:

Induction:

Developmental stage:

Protein families:fic family


   💬 WhatsApp