EI2BA_RAT Q64270
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64270
Recommended name:Translation initiation factor eIF2B subunit alpha
EC number:
Alternative names:
Cleaved into:
GeneID:64514
Gene names (primary ):Eif2b1
Gene names (synonym ):Eif2ba
Gene names (ORF ):
Length:305
Mass:33,678
Sequence:MEDGELIKYFKSQMKGDPNMASAVAAIQTLLEFLKRDKGETIQGLRAHLTKAIETLCAVDSSVAVSSGGELFLRFISLTSLEYSDYSKCKKIMIERGELFLSRISLSRTKIASLCHAFIKDGARILTHAYSRVVLRVLEEAVAAKKRFSVYITESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKVDLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKSVQAGQDLKEEHPWVDYTSPSLITLLFTDLGVLTPSAVSDELIKLYL
Tissue specificity:
Induction:
Developmental stage:
Protein families: