OPSB_RAT   Q63652


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q63652

Recommended name:Short-wave-sensitive opsin 1

EC number:

Alternative names:Blue cone photoreceptor pigment Blue-sensitive opsin (BOP) Short wavelength-sensitive cone opsin

Cleaved into:

GeneID:81644

Gene names  (primary ):Opn1sw

Gene names  (synonym ):Bcp

Gene names  (ORF ):

Length:346

Mass:39,062

Sequence:MSGEDEFYLFQNISSVGPWDGPQYHIAPVWAFHLQAAFMGFVFFAGTPLNATVLVATLHYKKLRQPLNYILVNVSLGGFLFCIFSVFTVFIASCHGYFLFGRHVCALEAFLGSVAGLVTGWSLAFLAFERYLVICKPFGNIRFNSKHALTVVLITWTIGIGVSIPPFFGWSRFIPEGLQCSCGPDWYTVGTKYRSEHYTWFLFIFCFIIPLSLICFSYFQLLRTLRAVAAQQQESATTQKAEREVSHMVVVMVGSFCLCYVPYAALAMYMVNNRNHGLYLRLVTIPAFFSKSSCVYNPIIYCFMNKQFRACILEMVCRKPMTDESDMSGSQKTEVSTVSSSKVGPH

Tissue specificity:Expressed in cone photoreceptor cells.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp