BST1_RAT Q63072
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63072
Recommended name：ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
EC number：EC:3.2.2.6
Alternative names：ADP-ribosyl cyclase 2 Bone marrow stromal antigen 1 (BST-1) Cyclic ADP-ribose hydrolase 2 (cADPR hydrolase 2)
Cleaved into：
GeneID：81506
Gene names (primary )：Bst1
Gene names (synonym )：
Gene names (ORF )：
Length：319
Mass：35,131
Sequence：MAVQACALSLRLGLWMSLLLPVLPGAGARAAGARWSGEGTTPHLQSIFLGRCAEYTTLLSLEPGNKNCTAIWEAFKVVLDKDPCSVLPSDYDLFINLSRHAIPRDKSLFWENNHLLVMSYAENTRRLMPLCDVLYGKVGDFLSWCRQENASGLDYQSCPTAEDCENNAVDAYWKSASMQYSRDSSGVINVMLNGSEPKGAYPTKGFFADFEIPYLQKDKITRIEIWVMHEVGGPHVESCGEGSVKILEDRLEALGFQHSCINDYPPVKFLMCVDHSTHPDCAMNSASASMWRESPALHAIGDISLIISLLVALASSSQA
Tissue specificity：Pancreatic islets, kidney, spleen, heart, thymus, intestine and salivary gland.
Induction：
Developmental stage：
Protein families：