S19A1_RAT Q62866
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62866
Recommended name:Reduced folate transporter Curated
EC number:
Alternative names:
Cleaved into:
GeneID:29723
Gene names (primary ):Slc19a1
Gene names (synonym ):
Gene names (ORF ):
Length:512
Mass:58,108
Sequence:MVPTGQVAEKQACEEPRQDRELKSWRWLVFYLCFFGFMAQLRPGESFITPYLLERNFTKEQVTNEIIPMLPYSHLAVLVPIFLLTDYLRYKPVLVLQCLSFVCVWLLLLLGTSVVHMQLMEVFYSITMAARIAYSSYIFSLVQPSRYQRMASYSRAAVLLGVFISSVLGQVLVTLGGISTYMLNCISLGFILFSLSLSLFLKRPKRSLFFNRSALVQGALPCELDQMHPGPGRPEPRKLERMLGTCRDSFLVRMLSELVKNVRQPQLRLWCLWWVFNSAGYYLITYYVHVLWKITDSRLNYNGAVDAASTLLSAITAFTAGFVNIRWALWSKLVIASVIAIQAGLVFCMFQIPDIWVCYVTFVLFRGAYQFLVPIATFQIASSLSKELCALVFGINTFLATALKTSITLVVSDKRGLGLQVHQQFRIYFMYFLTLSIICLAWAGLDGLRYYRRGRHQPLAQAQALSPLEDSVQAISLQDGDLRRPQPSAPQLLPEDGSVEDGRADLRVEAKA
Tissue specificity:Expressed in liver, heart, brain, spleen, lung and skeletal muscle. 1
Induction:
Developmental stage:
Protein families: