CALD1_RAT Q62736
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62736
Recommended name：Non-muscle caldesmon
EC number：
Alternative names：L-caldesmon
Cleaved into：
GeneID：25687
Gene names (primary )：Cald1
Gene names (synonym )：
Gene names (ORF )：
Length：531
Mass：60,584
Sequence：MLSRSGSQGRRCLATLSQIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLGQVTDQVEAHVQNSAPDEESKPATANAQVEGDEEAALLERLARREERRQKRLQEALERQKEFDPTITDGSLSVPSRRMQNNSAENETAEGEEKGESRSGRYEMEETEVVITSYQKNSYQDAEDKKKEEKEEEEEEEKLKGGNLGENQIKDEKIKKDKEPKEEVKNFLDRKKGFTEVKAQNGEFMTHKLKQTENAFSPSRSGGRASGDKEAEGAPQVEAGKRLEELRRRRGETESEEFEKLKQKQQEAALELEELKKKREERRKVLEEEEQRRKQEEADRKAREEEEKRRLKEEIERRRAEAAEKRQKMPEDGLSEDKKPFKCFTPKGSSLKIEERAEFLNKSVQKSGVKSTHQAAVVSKIDSRLEQYTNAIEGTKASKPMKPAASDLPVPAEGVRNIKSMWEKGSVFSSPSASGTPNKETAGLKVGVSSRINEWLTKSPDGNKSPAPKPSDLRPGDVSGKRNLWEKQSVDKVTSPTKV
Tissue specificity：High-molecular-weight caldesmon (h-caldesmon) is predominantly expressed in smooth muscles, whereas low-molecular-weight caldesmon (l-caldesmon) is widely distributed in non-muscle tissues and cells. Not expressed in skeletal muscle or heart.
Induction：
Developmental stage：
Protein families：caldesmon family