WDR83_RAT Q5BLX8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5BLX8
Recommended name：WD repeat domain-containing protein 83
EC number：
Alternative names：
Cleaved into：
GeneID：288924
Gene names (primary )：Wdr83
Gene names (synonym )：Morg1
Gene names (ORF )：
Length：315
Mass：34,382
Sequence：MAFPEPKPRAPELPRKQLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEVLDAAGSFDNSHLCSGGGDKTVVLWDVATGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSVRCWDCRSRKPEPVQTLDEARDGISSVKVSDHEILAGSVDGRVRRYDLRMGQVTSDYVGSPITCTCFSRDGQCTLISSLDSTLRLLDKDTGELLGEYVGHKNQKYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGSLALALPVGSNVVQSLAYHPADPCLLTAMGGSIQYWREETYEAEGGAG
Tissue specificity：Highly expressed in testis and brain. Expressed at intermediate level in heart, liver and kidney. Weakly expressed in spleen and lung and absent in muscle. 1
Induction：
Developmental stage：
Protein families：