AP4M1_RAT Q2PWT8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q2PWT8
Recommended name：AP-4 complex subunit mu-1 Curated
EC number：
Alternative names：
Cleaved into：
GeneID：304344
Gene names (primary )：Ap4m1
Gene names (synonym )：
Gene names (ORF )：
Length：453
Mass：49,853
Sequence：MISQFFILSSKGDPLIYKDFRGDSGGRDVAELFYRKLTGLPGGESPVVMYHDDRHFIHIRHSGLYLVATTSENVSPFSLLELLSRLATLLGDYCGSLNEGTISRNVALVYELLDEVLDYGYVQTTSTDMLRNFIQTEAAVSKPFSLFDLSSVGLFGAETQQNRVAPSSAASRPVLSSRSDQSQKNEVFLDVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSSSEICIGLTEEFCVGKSELRGYGPGIRVDEVSFHSSVNLDEFESHRILHLQPPQGELTVMRYQLSDDLPSPLPFRLFPSVQWDQGSGRLQVYLKLRCDLPPKSQALNIHLHLPLPRGVVSLSQELSSPDQKAELGEGALHWDLPRVQGGSQLSGLFQMDVPGLQGPPSRGPSPSAPPLGLGPASLSFELPRHTCSGLQVRFLRLSFSACGNANPHKWVRHLSHSNAYVIRI
Tissue specificity：High levels in the olfactory bulb, the cerebral cortex, the granule and Purkinje cell layers of the cerebellar cortex and the CA3 region of the hippocampus. Low levels found in molecular layer of cerebellum. 1
Induction：
Developmental stage：
Protein families：