HSPB6_RAT P97541
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97541
Recommended name：Heat shock protein beta-6
EC number：
Alternative names：Heat shock 20 kDa-like protein p20 (Hsp20 1 Publication)
Cleaved into：
GeneID：192245
Gene names (primary )：Hspb6
Gene names (synonym )：
Gene names (ORF )：
Length：162
Mass：17,505
Sequence：MEIRVPVQPSWLRRASAPLPGFSTPGRLFDQRFGEGLLEAELASLCPAAIAPYYLRAPSVALPTAQVPTDPGYFSVLLDVKHFSPEEISVKVVGDHVEVHARHEERPDEHGFIAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQATPASAQASLPSPPAAK
Tissue specificity：Widely expressed. High expression in muscle tissues. 1
Induction：
Developmental stage：
Protein families：