LHX1_RAT P63007
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63007
Recommended name：LIM/homeobox protein Lhx1
EC number：
Alternative names：Homeobox protein Lim-1 (Rlim)
Cleaved into：
GeneID：257634
Gene names (primary )：Lhx1
Gene names (synonym )：Lim-1, Lim1
Gene names (ORF )：
Length：406
Mass：44,780
Sequence：MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSREGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEELYIIDENKFVCKEDYLSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEGGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGDYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVPSSGPSGTPLGGLDHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW
Tissue specificity：Expressed in epithelial structures of the embryonic metanephric kidneys including the ureteric bud and its derivatives, and coma-shaped and S-shaped bodies differentiating from the metanephric mesenchyme. In the adult brain, expressed in the adrenal medulla, Purkinje cells of the cerebellum, hypothalamus, midbrain and pons. Also expressed in the adult testis. 2 s
Induction：
Developmental stage：
Protein families：