UB2G1_RAT P62255
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62255
Recommended name：Ubiquitin-conjugating enzyme E2 G1
EC number：EC:2.3.2.23
Alternative names：E2 ubiquitin-conjugating enzyme G1 E217K UBC7 Ubiquitin carrier protein G1 Ubiquitin-protein ligase G1
Cleaved into：
GeneID：64631
Gene names (primary )：Ube2g1
Gene names (synonym )：Ubc7, Ube2g
Gene names (ORF )：
Length：170
Mass：19,509
Sequence：MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE
Tissue specificity：Widely expressed, with higher level in testis. 1
Induction：
Developmental stage：Induced from days 15 to 30.
Protein families：