RAB14_RAT P61107
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61107
Recommended name：Ras-related protein Rab-14
EC number：EC:3.6.5.2
Alternative names：
Cleaved into：
GeneID：94197
Gene names (primary )：Rab14
Gene names (synonym )：
Gene names (ORF )：
Length：215
Mass：23,927
Sequence：MATTPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC
Tissue specificity：Widely expressed (at protein level). Highest levels found in whole brain, spinal cord, heart, kidney and lung.
Induction：
Developmental stage：
Protein families：