AP2A_RAT   P58197


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P58197

Recommended name:Transcription factor AP-2-alpha

EC number:

Alternative names:AP-2 transcription factor Activating enhancer-binding protein 2-alpha Activator protein 2 (AP-2)

Cleaved into:

GeneID:

Gene names  (primary ):Tfap2a

Gene names  (synonym ):Tcfap2a

Gene names  (ORF ):

Length:437

Mass:47,947

Sequence:MLWKLTDNIKYEDCEDRHDGTSNGTARLPQLGTVGQSPYTSAPPLSHTPNADFQPPYFPPPYQPIYPQSQDPYSHVNDPYSLNPLHAQPQPQHPGWPGQRQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHGLGSGLGDLPIHSLPHAIEDVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSSPECLNASLLGGVLRRAKSKNGGRSLREKLDKIGLNLPAGRRKAANVTLLTSLVEGEAVHLARDFGYVCETEFPAKAVAEFLNRQHSDPNEQVARKNMLLATKQICKEFTDLLAQDRSPLGNSRPNPILEPGIQSCLTHFNLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNSAKSSDKEEKHRK

Tissue specificity:In the brain, highly expressed in the hippocampus, hypothalamus and cerebral cortex.

Induction:

Developmental stage:During retinoic acid-mediated differentiation and by nerve growth factor (NGF). Inhibited by the antidepressants, citalopram and imipramin.

Protein families:AP-2 family


   💬 WhatsApp