CASP3_RAT P55213
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P55213
Recommended name：Caspase-3
EC number：EC:3.4.22.56
Alternative names：CASP-3
Cleaved into：
GeneID：25402
Gene names (primary )：Casp3
Gene names (synonym )：Cpp32
Gene names (ORF )：
Length：277
Mass：31,492
Sequence：MDNNETSVDSKSINNFETKTIHGSKSMDSGIYLDSSYKMDYPEMGLCIIINNKNFHKSTGMSARNGTDVDAANLRETFMALKYEVRNKNDLTREEIMELMDSVSKEDHSKRSSFVCVILSHGDEGVIFGTNGPVDLKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDDDMACQKIPVEADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKLYAHKLEFMHILTRVNRKVATEFESFSLDATFHAKKQIPCIVSMLTKELYFYH
Tissue specificity：Expressed in heart, brain, liver, and muscle but not in kidney or testis.
Induction：
Developmental stage：Highly expressed in neuron-enriched regions of the developing brain, but down-regulated to low levels in the adult brain.
Protein families：