EGR2_RAT   P51774


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P51774

Recommended name:E3 SUMO-protein ligase EGR2

EC number:EC:2.3.2.-

Alternative names:E3 SUMO-protein transferase ERG2 Curated Early growth response protein 2 (EGR-2) Zinc finger protein Krox-20

Cleaved into:

GeneID:

Gene names  (primary ):Egr2

Gene names  (synonym ):Egr-2, Krox-20, Krox20

Gene names  (ORF ):

Length:470

Mass:49,849

Sequence:MMTAKAVDKIPVTLSGFMHQLPDSLYPVEDLAAPSVTIFPNGELGGPFDQMNGVAGDGMINIDMTGEKRPLDLPYPSSFAPISAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGILQGVTPPASTTASSSVTSASPNPLATGPLGVCTMSQTQPELDHLYSPPPPPPPYSGCTGDLYQDPSAFLSPPPTTSTSSLAYQPPPSYPSPKPAMDPGLIPMIPDYPGFFPSPCQRDPHGAAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGGEGPRLPGSGSAAVTATPYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSSSASAQSSASGPGGSQAGGSLCGNSAIGGPLASCTSRTRTP

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp