MMP7_RAT P50280
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50280
Recommended name：Matrilysin
EC number：EC:3.4.24.23
Alternative names：Matrin Matrix metalloproteinase-7 (MMP-7) Pump-1 protease Uterine metalloproteinase
Cleaved into：
GeneID：25335
Gene names (primary )：Mmp7
Gene names (synonym )：Mmp-7
Gene names (ORF )：
Length：267
Mass：29,885
Sequence：MAAMRLTLFRIVCLLPGCLALPLSQEAGEVTALQWEQAQNYLRKFYLHDSKTKKATSAVDKLREMQKFFGLPETGKLSPRVMEIMQKPRCGVPDVAEFSLMPNSPKWHSRTVTYRIVSYTTDLPRFLVDQIVKRALRMWSMQIPLNFKRVSWGTADIIIGFARGDHGDNFPFDGPGNTLGHAFAPGPGLGGDAHFDKDEYWTDGEDSGVNFLFVATHELGHSLGLGHSSVPSSVMYPTYQGDHSEDFSLTKDDIAGIQKLYGKRNKL
Tissue specificity：
Induction：
Developmental stage：
Protein families：peptidase M10A family